Recombinant Human CRYGB Protein, GST-tagged
Cat.No. : | CRYGB-1938H |
Product Overview : | Human CRYGB partial ORF ( NP_005201.1, 76 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | IRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCLSVQDRFHLTEIHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRYGB crystallin, gamma B [ Homo sapiens ] |
Official Symbol | CRYGB |
Synonyms | CRGB_HUMAN; Crygb; Gamma-B-crystallin; Gamma-crystallin 1-2; Gamma-crystallin B; crystallin, gamma B; Gamma-crystallin 1-2; CRYGB |
Gene ID | 1419 |
mRNA Refseq | NM_005210.3 |
Protein Refseq | NP_005201.2 |
MIM | 123670 |
UniProt ID | P07316 |
◆ Recombinant Proteins | ||
CRYGB-3943M | Recombinant Mouse CRYGB Protein | +Inquiry |
CRYGB-1275R | Recombinant Rat CRYGB Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYGB-2735H | Recombinant Human CRYGB protein, His-tagged | +Inquiry |
CRYGB-1938H | Recombinant Human CRYGB Protein, GST-tagged | +Inquiry |
CRYGB-1043R | Recombinant Rhesus monkey CRYGB Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYGB-7259HCL | Recombinant Human CRYGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYGB Products
Required fields are marked with *
My Review for All CRYGB Products
Required fields are marked with *