Recombinant Rat Csf3 protein

Cat.No. : Csf3-9291R
Product Overview : Recombinant Rat Csf3 protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 195
Description : The protein is a putative hematopoetic growth factor for neutrophils, and wase used as a treatment for cyclic hematopoesis in humans and dogs.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in 5 mM Sodium Citrate, pH 4.0.
Bio-activity : Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg.
Molecular Mass : Approximately 21.5 kDa, a single non-glycosylated polypeptide chain containing 195 amino acids.
AA Sequence : KKIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI
Endotoxin : Less than 0.1 EU/μg of rRtG-CSF as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Csf3
Official Symbol Csf3
Synonyms CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor;
Gene ID 25610
mRNA Refseq NM_017104
Protein Refseq NP_058800
UniProt ID P97712

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf3 Products

Required fields are marked with *

My Review for All Csf3 Products

Required fields are marked with *

0
cart-icon