Recombinant Rat Dbi protein, His&Myc-tagged
| Cat.No. : | Dbi-2801R |
| Product Overview : | Recombinant Rat Dbi protein(P11030)(2-87aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 2-87aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 16.9 kDa |
| AA Sequence : | SQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYGI |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Dbi diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [ Rattus norvegicus ] |
| Official Symbol | Dbi |
| Synonyms | DBI; diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein); acyl-CoA-binding protein; LRRGT00046; endozepine; octadecaneuropeptide; GABA receptor modulator; diazepam-binding inhibitor; triakontatetraneuropeptide; Diazepam binding inhibitor (GABA receptor modulator acyl-Coenxyme A binding protein); Diazepam binding inhibitor (GABA receptor modulator, acyl-Coenxyme A binding protein); diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein); Ep; Odn; Ttn; Acbp; Acoabp3; RNACOABP3; |
| Gene ID | 25045 |
| mRNA Refseq | NM_031853 |
| Protein Refseq | NP_114054 |
| ◆ Recombinant Proteins | ||
| DBI-2566HF | Recombinant Full Length Human DBI Protein, GST-tagged | +Inquiry |
| DBI-11842H | Recombinant Human DBI, His-tagged | +Inquiry |
| Dbi-688M | Recombinant Mouse Dbi protein, His&Myc-tagged | +Inquiry |
| DBI-2367H | Recombinant Human DBI Protein, GST-tagged | +Inquiry |
| DBI-1437R | Recombinant Rat DBI Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DBI-7066HCL | Recombinant Human DBI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Dbi Products
Required fields are marked with *
My Review for All Dbi Products
Required fields are marked with *
