Recombinant Rat Dpp4 protein, His-SUMO-tagged
| Cat.No. : | Dpp4-2823R |
| Product Overview : | Recombinant Rat Dpp4 protein(P14740)(638-767aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 638-767aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.7 kDa |
| AA Sequence : | SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Dpp4 dipeptidylpeptidase 4 [ Rattus norvegicus ] |
| Official Symbol | Dpp4 |
| Synonyms | DPP4; dipeptidylpeptidase 4; dipeptidyl peptidase 4; DPP IV; GP110 glycoprotein; dipeptidyl peptidase IV; T-cell activation antigen CD26; bile canaliculus domain-specific membrane glycoprotein; CD26; DPPIV; |
| Gene ID | 25253 |
| mRNA Refseq | NM_012789 |
| Protein Refseq | NP_036921 |
| ◆ Recombinant Proteins | ||
| Dpp4-415M | Active Recombinant Mouse DPP4 protein, His-tagged | +Inquiry |
| DPP4-5830H | Recombinant Human DPP4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Dpp4-2369M | Recombinant Mouse Dpp4 protein, His-SUMO-tagged | +Inquiry |
| DPP4-215H | Active Recombinant Human DPP4 protein, His-tagged | +Inquiry |
| DPP4-3739H | Human 1PFQ | +Inquiry |
| ◆ Native Proteins | ||
| DPP4-31H | Active Native Human DPP4 | +Inquiry |
| DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DPP4-2979HCL | Recombinant Human DPP4 cell lysate | +Inquiry |
| DPP4-733CCL | Recombinant Cynomolgus DPP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Dpp4 Products
Required fields are marked with *
My Review for All Dpp4 Products
Required fields are marked with *
