Recombinant Rat Epor protein, His-SUMO&His-tagged
| Cat.No. : | Epor-4240R |
| Product Overview : | Recombinant Rat Epor protein(Q07303)(25-249aa), fused to N-terminal His tag and SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 25-249aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.1 kDa |
| AA Sequence : | ASSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAANSGMGFNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Epor erythropoietin receptor [ Rattus norvegicus ] |
| Official Symbol | Epor |
| Synonyms | EPOR; erythropoietin receptor; EPO-R; MGC108723; |
| Gene ID | 24336 |
| mRNA Refseq | NM_017002 |
| Protein Refseq | NP_058698 |
| ◆ Recombinant Proteins | ||
| Epor-212M | Recombinant Mouse Epor, Fc-His tagged | +Inquiry |
| Epor-42M | Recombinant Mouse Epor Protein, His (Fc)-Avi-tagged | +Inquiry |
| EPOR-194H | Recombinant Human EPOR protein, His-tagged | +Inquiry |
| EPOR-1434H | Recombinant Human EPOR Protein, His-tagged | +Inquiry |
| Epor-10550M | Recombinant Mouse Epor Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPOR-2055HCL | Recombinant Human EPOR cell lysate | +Inquiry |
| EPOR-2582MCL | Recombinant Mouse EPOR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Epor Products
Required fields are marked with *
My Review for All Epor Products
Required fields are marked with *
