Recombinant Cynomolgus Monkey FXN Protein (81-210 aa), His-tagged

Cat.No. : FXN-1060M
Product Overview : Recombinant Cynomolgus Monkey (Macaca fascicularis) (Crab-eating macaque) FXN Protein (81-210 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : E.coli
Tag : His
Protein Length : 81-210 aa
Description : Promotes the biosynthesis of he and assbly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 18.2 kDa
AA Sequence : SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
UniProt ID Q8HXX9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FXN Products

Required fields are marked with *

My Review for All FXN Products

Required fields are marked with *

0
cart-icon