Recombinant Rat Gba2 protein, His-tagged
Cat.No. : | Gba2-643R |
Product Overview : | Recombinant Rat Gba2 protein(Q5M868)(512-877aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 512-877aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GRFGYLEGQEYRMYNTYDVHFYASFALVMLWPKLELSLQYDMALATFKEDLTRRRYLMSGVVAPVKRRNVIPHDIGDPDDEPWLRVNAYLIHDTADWKDLNLKFVLQVYRDYYLTGDQGFLKDMWPVCLAVMESEMKFDKDQDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAVLCGAQDVQDKFSSILCRGREAYERLLWNGRYYNYDSSSQPQSRSVMSDQCAGQWFLRACGLGEGDTEVFPTLHVVRALKTIFELNVQAFAGGAMGAVNGMQPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAM |
Gene Name | Gba2 glucosidase beta 2 [ Rattus norvegicus ] |
Official Symbol | Gba2 |
Synonyms | GBA2; glucosidase beta 2; non-lysosomal glucosylceramidase; NLGase; beta-glucosidase 2; glucosylceramidase 2; beta-glucocerebrosidase 2; bile acid beta-glucosidase; |
Gene ID | 298399 |
mRNA Refseq | NM_001013091 |
Protein Refseq | NP_001013109 |
◆ Recombinant Proteins | ||
Gba2-3166M | Recombinant Mouse Gba2 Protein, Myc/DDK-tagged | +Inquiry |
GBA2-5517HF | Recombinant Full Length Human GBA2 Protein, GST-tagged | +Inquiry |
GBA2-4767H | Recombinant Human GBA2 Protein, GST-tagged | +Inquiry |
GBA2-966H | Recombinant Human GBA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GBA2-6236M | Recombinant Mouse GBA2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GBA2-6001HCL | Recombinant Human GBA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gba2 Products
Required fields are marked with *
My Review for All Gba2 Products
Required fields are marked with *