Recombinant Rat Gipr protein, His-tagged

• Cat.No.: Gipr-4651R
• Product Overview: Recombinant Rat Gipr protein(P43219)(19-135 aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• Protein Length: 19-135 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 15.5 kDa
• AASequence: RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Gipr gastric inhibitory polypeptide receptor [ Rattus norvegicus ]
• Official Symbol: Gipr
• Synonyms: GIPR; gastric inhibitory polypeptide receptor; GIP-R; gastric inhibitory peptide receptor; glucose-dependent insulinotropic polypeptide receptor; Gippr; RATGIPPR
• Gene ID: 25024
• mRNA Refseq: NM_012714
• Protein Refseq: NP_036846