Recombinant Rat Gipr protein, His-tagged
Cat.No. : | Gipr-4651R |
Product Overview : | Recombinant Rat Gipr protein(P43219)(19-135 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 19-135 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 15.5 kDa |
AASequence : | RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Gipr gastric inhibitory polypeptide receptor [ Rattus norvegicus ] |
Official Symbol | Gipr |
Synonyms | GIPR; gastric inhibitory polypeptide receptor; GIP-R; gastric inhibitory peptide receptor; glucose-dependent insulinotropic polypeptide receptor; Gippr; RATGIPPR; |
Gene ID | 25024 |
mRNA Refseq | NM_012714 |
Protein Refseq | NP_036846 |
◆ Recombinant Proteins | ||
GIPR-294HCL | Recombinant Human GIPR HEK293T Over-expression Lysate | +Inquiry |
RFL12063RF | Recombinant Full Length Rat Gastric Inhibitory Polypeptide Receptor(Gipr) Protein, His-Tagged | +Inquiry |
GIPR-13267H | Recombinant Human GIPR, GST-tagged | +Inquiry |
GIPR-2543R | Recombinant Rat GIPR Protein | +Inquiry |
Gipr-5643R | Recombinant Rat Gipr protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gipr Products
Required fields are marked with *
My Review for All Gipr Products
Required fields are marked with *
0
Inquiry Basket