Recombinant Human GIPR protein, His-tagged
Cat.No. : | GIPR-2961H |
Product Overview : | Recombinant Human GIPR protein(P48546)(22-138aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-138aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.5 kDa |
AA Sequence : | RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GIPR gastric inhibitory polypeptide receptor [ Homo sapiens ] |
Official Symbol | GIPR |
Synonyms | GIPR; gastric inhibitory polypeptide receptor; GIP-R; glucose-dependent insulinotropic polypeptide receptor; PGQTL2; MGC126722; |
Gene ID | 2696 |
mRNA Refseq | NM_000164 |
Protein Refseq | NP_000155 |
UniProt ID | P48546 |
◆ Recombinant Proteins | ||
RFL32302HF | Recombinant Full Length Human Gastric Inhibitory Polypeptide Receptor(Gipr) Protein, His-Tagged | +Inquiry |
GIPR-5016H | Recombinant Human GIPR protein, His&Myc-tagged | +Inquiry |
GIPR-2199R | Recombinant Rat GIPR Protein, His (Fc)-Avi-tagged | +Inquiry |
GIPR-2961H | Recombinant Human GIPR protein, His-tagged | +Inquiry |
GIPR-1354H | Recombinant Human GIPR protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIPR Products
Required fields are marked with *
My Review for All GIPR Products
Required fields are marked with *
0
Inquiry Basket