Recombinant Rat Gipr protein, His-tagged

• Cat.No.: Gipr-5643R
• Product Overview: Recombinant Rat Gipr protein(P43219)(19-135aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Protein Length: 19-135aa
• Tag: C-His
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2 μg/mL can bind Anti-Mouse Gipr recombinant antibody, the EC50 is 6.946-8.740 ng/ml.
• Molecular Mass: 14.9 kDa
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ

Gene Information

• Gene Name: Gipr gastric inhibitory polypeptide receptor [ Rattus norvegicus ]
• Official Symbol: Gipr
• Synonyms: GIPR; gastric inhibitory polypeptide receptor; GIP-R; gastric inhibitory peptide receptor; glucose-dependent insulinotropic polypeptide receptor; Gippr; RATGIPPR
• Gene ID: 25024
• mRNA Refseq: NM_012714
• Protein Refseq: NP_036846