Recombinant Human GLP1R protein, His-tagged
Cat.No. : | GLP1R-6744H |
Product Overview : | Recombinant Human GLP1R protein(P43220)(24-145aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-145a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
Gene Name | GLP1R glucagon-like peptide 1 receptor [ Homo sapiens ] |
Official Symbol | GLP1R |
Synonyms | GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331; |
Gene ID | 2740 |
mRNA Refseq | NM_002062 |
Protein Refseq | NP_002053 |
MIM | 138032 |
UniProt ID | P43220 |
◆ Recombinant Proteins | ||
RFL14750RF | Recombinant Full Length Rat Glucagon-Like Peptide 1 Receptor(Glp1R) Protein, His-Tagged | +Inquiry |
GLP1R-22H | Recombinant Human GLP1R Protein, Biotinylated | +Inquiry |
Glp1r-2967R | Recombinant Rat Glp1r protein, His-tagged | +Inquiry |
GLP1R-1228H | Recombinant Human GLP1R Protein, His-tagged | +Inquiry |
GLP1R-584H | Recombinant Human GLP1R protein, mFc-tagged | +Inquiry |
◆ Native Proteins | ||
GLP1R-549C | Recombinant Cynomolgus GLP1R Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLP1R Products
Required fields are marked with *
My Review for All GLP1R Products
Required fields are marked with *