Recombinant Rat Glp1r protein, His-tagged
Cat.No. : | Glp1r-2223R |
Product Overview : | Recombinant Rat Glp1r protein(P32301)(22-135aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 22-135aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.6 kDa |
AA Sequence : | GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Glp1r glucagon-like peptide 1 receptor [ Rattus norvegicus ] |
Official Symbol | Glp1r |
Synonyms | GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1; Glip; RATGL1RCP; |
Gene ID | 25051 |
mRNA Refseq | NM_012728 |
Protein Refseq | NP_036860 |
◆ Recombinant Proteins | ||
GLP1R-1932H | Active Recombinant Human GLP1R Full Length Transmembrane protein(Nanodisc) | +Inquiry |
GLP1R-2755H | Recombinant Human GLP1R Protein, His-tagged | +Inquiry |
GLP1R-1229M | Recombinant Mouse GLP1R Protein, His-SUMO-tagged | +Inquiry |
Glp1r-5416R | Recombinant Rat Glp1r protein, His-tagged | +Inquiry |
GLP1R-1105HFL | Recombinant Human GLP1R protein, His&Flag-tagged | +Inquiry |
◆ Native Proteins | ||
GLP1R-549C | Recombinant Cynomolgus GLP1R Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Glp1r Products
Required fields are marked with *
My Review for All Glp1r Products
Required fields are marked with *