Recombinant Rat Glp1r protein, His-tagged

Cat.No. : Glp1r-2223R
Product Overview : Recombinant Rat Glp1r protein(P32301)(22-135aa), fused to N-terminal His tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Insect Cells
Tag : His
Protein Length : 22-135aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 15.6 kDa
AA Sequence : GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Glp1r glucagon-like peptide 1 receptor [ Rattus norvegicus ]
Official Symbol Glp1r
Synonyms GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1; Glip; RATGL1RCP;
Gene ID 25051
mRNA Refseq NM_012728
Protein Refseq NP_036860

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Glp1r Products

Required fields are marked with *

My Review for All Glp1r Products

Required fields are marked with *

0
cart-icon