Recombinant Rat HSD17B10 Protein (2-261 aa), His-tagged
Cat.No. : | HSD17B10-2273R |
Product Overview : | Recombinant Rat HSD17B10 Protein (2-261 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-261 aa |
Description : | Functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/TRMT10C, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends. Catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. Catalyzes the third step in the beta-oxidation of fatty acids. Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 29.1 kDa |
AA Sequence : | AAAVRSVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Hsd17b10 hydroxysteroid (17-beta) dehydrogenase 10 [ Rattus norvegicus ] |
Official Symbol | HSD17B10 |
Synonyms | HSD17B10; type II HADH; 17-beta-HSD 10; Hadh2; |
Gene ID | 63864 |
mRNA Refseq | NM_031682 |
Protein Refseq | NP_113870 |
UniProt ID | O70351 |
◆ Recombinant Proteins | ||
HSD17B10-1604Z | Recombinant Zebrafish HSD17B10 | +Inquiry |
Hsd17b10-1093M | Recombinant Mouse Hsd17b10 Protein, MYC/DDK-tagged | +Inquiry |
HSD17B10-597C | Recombinant Cynomolgus HSD17B10 Protein, His-tagged | +Inquiry |
HSD17B10-4781H | Recombinant Human HSD17B10 Protein, Myc/DDK-tagged | +Inquiry |
Hsd17b10-1408M | Recombinant Mouse Hsd17b10 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B10-5376HCL | Recombinant Human HSD17B10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B10 Products
Required fields are marked with *
My Review for All HSD17B10 Products
Required fields are marked with *
0
Inquiry Basket