Recombinant Rat Hspb6 protein, His-tagged
| Cat.No. : | Hspb6-644R |
| Product Overview : | Recombinant Rat Hspb6 protein(P97541)(1-162aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-162a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 24.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MEIRVPVQPSWLRRASAPLPGFSTPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQASLPSPPAAK |
| Gene Name | Hspb6 heat shock protein, alpha-crystallin-related, B6 [ Rattus norvegicus ] |
| Official Symbol | Hspb6 |
| Synonyms | HSPB6; heat shock protein, alpha-crystallin-related, B6; heat shock protein beta-6; heat shock 20-kDa protein; heat shock 20 kDa-like protein p20; p20; Hsp20; |
| Gene ID | 192245 |
| mRNA Refseq | NM_138887 |
| Protein Refseq | NP_620242 |
| ◆ Recombinant Proteins | ||
| HSPB6-28487TH | Recombinant Human HSPB6 | +Inquiry |
| HSPB6-2169R | Recombinant Rhesus monkey HSPB6 Protein, His-tagged | +Inquiry |
| HSPB6-5908Z | Recombinant Zebrafish HSPB6 | +Inquiry |
| HSPB6-1253H | Recombinant Human Heat Shock Protein, Alpha-crystallin-related, B6 | +Inquiry |
| HSPB6-2953R | Recombinant Rat HSPB6 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSPB6-5347HCL | Recombinant Human HSPB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hspb6 Products
Required fields are marked with *
My Review for All Hspb6 Products
Required fields are marked with *
