Recombinant Rat Hspb6 protein, His-tagged
Cat.No. : | Hspb6-644R |
Product Overview : | Recombinant Rat Hspb6 protein(P97541)(1-162aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-162a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MEIRVPVQPSWLRRASAPLPGFSTPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQASLPSPPAAK |
Gene Name | Hspb6 heat shock protein, alpha-crystallin-related, B6 [ Rattus norvegicus ] |
Official Symbol | Hspb6 |
Synonyms | HSPB6; heat shock protein, alpha-crystallin-related, B6; heat shock protein beta-6; heat shock 20-kDa protein; heat shock 20 kDa-like protein p20; p20; Hsp20; |
Gene ID | 192245 |
mRNA Refseq | NM_138887 |
Protein Refseq | NP_620242 |
◆ Recombinant Proteins | ||
Hspb6-1450R | Recombinant Rat Hspb6 protein, His-tagged | +Inquiry |
HSPB6-2169R | Recombinant Rhesus monkey HSPB6 Protein, His-tagged | +Inquiry |
HSPB6-28487TH | Recombinant Human HSPB6 | +Inquiry |
HSPB6-1990R | Recombinant Rhesus Macaque HSPB6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPB6-13992H | Recombinant Human HSPB6, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB6-5347HCL | Recombinant Human HSPB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hspb6 Products
Required fields are marked with *
My Review for All Hspb6 Products
Required fields are marked with *
0
Inquiry Basket