Recombinant Rat Il11 protein, His-tagged
Cat.No. : | Il11-4544R |
Product Overview : | Recombinant Rat Il11 protein(Q99MF5)(22-199 aa), fused with N-terminal His tag, was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Mammalian Cells |
Tag : | His |
Protein Length : | 22-199 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 22.8 kDa |
AASequence : | PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Il11 interleukin 11 [ Rattus norvegicus ] |
Official Symbol | Il11 |
Synonyms | IL11; interleukin 11; interleukin-11; Il-11; |
Gene ID | 171040 |
mRNA Refseq | NM_133519 |
Protein Refseq | NP_598203 |
◆ Recombinant Proteins | ||
Il11-476R | Recombinant Rat Il11 protein, His-tagged | +Inquiry |
IL11-2597H | Active Recombinant Human IL11 protein | +Inquiry |
Il11-138M | Recombinant Active Mouse IL11 Protein, His-tagged(N-ter) | +Inquiry |
Il11-1659R | Recombinant Rat Il11 Protein, His-tagged | +Inquiry |
IL11-2289H | Recombinant Human IL11 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il11 Products
Required fields are marked with *
My Review for All Il11 Products
Required fields are marked with *
0
Inquiry Basket