Recombinant Rat Il11 protein, His-tagged
| Cat.No. : | Il11-4544R |
| Product Overview : | Recombinant Rat Il11 protein(Q99MF5)(22-199 aa), fused with N-terminal His tag, was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Mammalian Cells |
| Tag : | His |
| Protein Length : | 22-199 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 22.8 kDa |
| AASequence : | PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Il11 interleukin 11 [ Rattus norvegicus ] |
| Official Symbol | Il11 |
| Synonyms | IL11; interleukin 11; interleukin-11; Il-11; |
| Gene ID | 171040 |
| mRNA Refseq | NM_133519 |
| Protein Refseq | NP_598203 |
| ◆ Recombinant Proteins | ||
| Il11-161M | Recombinant Mouse Il11 protein | +Inquiry |
| Il11-842M | Recombinant Mouse Il11 protein(Pro22-Leu199) | +Inquiry |
| Il11-1373M | Recombinant Mouse Il11 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
| Il11-46M | Active Recombinant Mouse Il11 Protein (Pro22-Leu199), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| IL11-123H | Recombinant Human IL11 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il11 Products
Required fields are marked with *
My Review for All Il11 Products
Required fields are marked with *
