Recombinant Rat IL17F Protein
| Cat.No. : | IL17F-145R |
| Product Overview : | Recombinant Rat IL17F Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Description : | Interleukin 17F (IL-17F), a member of the IL-17 cytokine family, is secreted by activated CD4+ T cells and monocytes. |
| Bio-activity : | No biological activity data is available at this time. |
| AA Sequence : | MARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Gene Name | Il17f interleukin 17F [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | IL17F |
| Synonyms | IL17F; interleukin 17F; interleukin-17F; IL-17F; MGC114402; |
| Gene ID | 301291 |
| mRNA Refseq | NM_001015011 |
| Protein Refseq | NP_001015011 |
| UniProt ID | Q5BJ95 |
| ◆ Recombinant Proteins | ||
| IL17F-366H | Active Recombinant Human Interleukin 17F, HIgG1 Fc-tagged, mutant | +Inquiry |
| IL17F-28H | Active Recombinant Human IL17F Protein, Animal Free | +Inquiry |
| IL17F-2684R | Recombinant Rat IL17F Protein, His (Fc)-Avi-tagged | +Inquiry |
| IL17F-377HB | Recombinant Human IL17F protein(Arg31-Gln163), His-tagged, Biotinylated | +Inquiry |
| IL17F-151H | Recombinant Active Human IL17F Protein, His-tagged(C-ter) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL17F-2045HCL | Recombinant Human IL17F cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17F Products
Required fields are marked with *
My Review for All IL17F Products
Required fields are marked with *



