Recombinant Rat Itgb4 protein, His-tagged
Cat.No. : | Itgb4-2440R |
Product Overview : | Recombinant Rat Itgb4 protein(Q64632)(28-713aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-713aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 80.7 kDa |
AA Sequence : | SLTENVEEFWDKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDATGAYTQYKTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELLEEAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDIDGTHVCQLAKEDQRGNIHLKPSFSDGLRMDASVICDMCACELQKEVQSARCHYRGDFMCGHCVCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGLGFCECGRCHCNQRSSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGSPGPNSTVLVHKKKDCLPAPS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Itgb4 integrin, beta 4 [ Rattus norvegicus ] |
Official Symbol | Itgb4 |
Synonyms | ITGB4; integrin, beta 4; integrin beta-4; GP150; |
Gene ID | 25724 |
mRNA Refseq | NM_013180 |
Protein Refseq | NP_037312 |
◆ Recombinant Proteins | ||
ITGB4-5769H | Recombinant Human ITGB4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ITGB4-2772R | Recombinant Rat ITGB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGB4-4972H | Recombinant Human ITGB4 Protein, GST-tagged | +Inquiry |
ITGB4-4334H | Recombinant Human ITGB4 protein, His&Myc-tagged | +Inquiry |
ITGB4-4329H | Recombinant Human ITGB4 Protein (Met1-Ser710), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Itgb4 Products
Required fields are marked with *
My Review for All Itgb4 Products
Required fields are marked with *
0
Inquiry Basket