Recombinant Rat KLKB1 Protein, His-tagged
Cat.No. : | KLKB1-1267R |
Product Overview : | Recombinant Rat KLKB1 Protein (391-638aa) was expressed in Yeast with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 391-638 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 29.8 kDa |
AA Sequence : | IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNK TPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGE TQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGE GCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Klkb1 kallikrein B1 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | KLKB1 |
Synonyms | PK; Klk3; Kalp1; KALP15; fletcher factor; kallikrein B, plasma 1; kininogenin; plasma prekallikrein |
Gene ID | 25048 |
mRNA Refseq | NM_012725.2 |
Protein Refseq | NP_036857.2 |
UniProt ID | Q5FVS2 |
◆ Recombinant Proteins | ||
KLKB1-483H | Active Recombinant Human Kallikrein B, Plasma (Fletcher factor) 1, His-tagged | +Inquiry |
KLKB1-1815H | Recombinant Human KLKB1 protein, His & T7-tagged | +Inquiry |
KLKB1-2202H | Recombinant Human KLKB1 Protein (20-390 aa), His-tagged | +Inquiry |
KLKB1-4355H | Recombinant Human KLKB1 Protein (Met1-Ala638), C-His tagged | +Inquiry |
KLKB1-4354H | Recombinant Human KLKB1 Protein (Ala65-Phe348), N-His tagged | +Inquiry |
◆ Native Proteins | ||
KLKB1-211S | Active Native Porcine Kallikrein | +Inquiry |
KLKB1-210H | Active Native Human Kallikrein | +Inquiry |
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLKB1-4899HCL | Recombinant Human KLKB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLKB1 Products
Required fields are marked with *
My Review for All KLKB1 Products
Required fields are marked with *
0
Inquiry Basket