Recombinant Rat KLKB1 Protein, His-tagged
| Cat.No. : | KLKB1-1267R |
| Product Overview : | Recombinant Rat KLKB1 Protein (391-638aa) was expressed in Yeast with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 391-638 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 29.8 kDa |
| AA Sequence : | IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNK TPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGE TQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGE GCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Klkb1 kallikrein B1 [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | KLKB1 |
| Synonyms | PK; Klk3; Kalp1; KALP15; fletcher factor; kallikrein B, plasma 1; kininogenin; plasma prekallikrein |
| Gene ID | 25048 |
| mRNA Refseq | NM_012725.2 |
| Protein Refseq | NP_036857.2 |
| UniProt ID | Q5FVS2 |
| ◆ Recombinant Proteins | ||
| KLKB1-1815H | Recombinant Human KLKB1 protein, His & T7-tagged | +Inquiry |
| Klkb1-117M | Recombinant Mouse Klkb1 Protein, His-tagged | +Inquiry |
| Klkb1-1277M | Recombinant Mouse Klkb1 Protein, MYC/DDK-tagged | +Inquiry |
| KLKB1-1499C | Recombinant Cynomolgus KLKB1 protein, His-tagged | +Inquiry |
| KLKB1-8757M | Recombinant Mouse KLKB1 Protein | +Inquiry |
| ◆ Native Proteins | ||
| KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
| KLKB1-210H | Active Native Human Kallikrein | +Inquiry |
| KLKB1-211S | Active Native Porcine Kallikrein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLKB1-4899HCL | Recombinant Human KLKB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLKB1 Products
Required fields are marked with *
My Review for All KLKB1 Products
Required fields are marked with *



