Recombinant Rat LEFTY1, His-tagged

Cat.No. : LEFTY1-27R
Product Overview : Recombinant Rat LEFTY1, fused to His-tag, was expressed in HEK293.
Availability July 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His
Description : Predicted to enable cytokine activity and nodal binding activity. Predicted to be involved in several processes, including negative regulation of nodal receptor complex assembly; regulation of transmembrane receptor protein serine/threonine kinase signaling pathway; and transmembrane receptor protein serine/threonine kinase signaling pathway. Predicted to act upstream of or within several processes, including anterior/posterior axis specification; cell migration involved in gastrulation; and response to retinoic acid. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to several human genes including LEFTY1 (left-right determination factor 1).
Form : PBS, pH7.4
Molecular Mass : 40.66 kDa
AA Sequence : LTGEQVLGSLLQQLRLDRPPVLDKADVEGMVIPSHVRAQYVALLQHSHDSRSRGKRFSQNFREVAGRFLVSETSSHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFREDGSNRTALIDSRLVSIHESGWKVFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGLGEPQLELHTLDLKDYGAQGNCDPETPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQPPESLTIRWPFLGPRQCVASEMTSLPLIVSIKEDGRTRPQVVSLPNMRVQRCSCASDGALIPRRLEPDDDDKHHHHHH
Endotoxin : <1EU/ug by LAL.
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.67mg/ml
Gene Name Lefty1 left right determination factor 1 [ Rattus norvegicus (Norway rat) ]
Official Symbol LEFTY1
Synonyms RGD1561867
Gene ID 498299
mRNA Refseq NM_001109080
Protein Refseq NP_001102550
UniProt ID D4A670

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LEFTY1 Products

Required fields are marked with *

My Review for All LEFTY1 Products

Required fields are marked with *

0
cart-icon