Recombinant Rat LEFTY1, His-tagged
| Cat.No. : | LEFTY1-27R |
| Product Overview : | Recombinant Rat LEFTY1, fused to His-tag, was expressed in HEK293. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | HEK293 |
| Tag : | His |
| Description : | Predicted to enable cytokine activity and nodal binding activity. Predicted to be involved in several processes, including negative regulation of nodal receptor complex assembly; regulation of transmembrane receptor protein serine/threonine kinase signaling pathway; and transmembrane receptor protein serine/threonine kinase signaling pathway. Predicted to act upstream of or within several processes, including anterior/posterior axis specification; cell migration involved in gastrulation; and response to retinoic acid. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to several human genes including LEFTY1 (left-right determination factor 1). |
| Form : | PBS, pH7.4 |
| Molecular Mass : | 40.66 kDa |
| AA Sequence : | LTGEQVLGSLLQQLRLDRPPVLDKADVEGMVIPSHVRAQYVALLQHSHDSRSRGKRFSQNFREVAGRFLVSETSSHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFREDGSNRTALIDSRLVSIHESGWKVFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGLGEPQLELHTLDLKDYGAQGNCDPETPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQPPESLTIRWPFLGPRQCVASEMTSLPLIVSIKEDGRTRPQVVSLPNMRVQRCSCASDGALIPRRLEPDDDDKHHHHHH |
| Endotoxin : | <1EU/ug by LAL. |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.67mg/ml |
| Gene Name | Lefty1 left right determination factor 1 [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | LEFTY1 |
| Synonyms | RGD1561867 |
| Gene ID | 498299 |
| mRNA Refseq | NM_001109080 |
| Protein Refseq | NP_001102550 |
| UniProt ID | D4A670 |
| ◆ Recombinant Proteins | ||
| Lefty1-579M | Active Recombinant Mouse Left Right Determination Factor 1 | +Inquiry |
| LEFTY1-367H | Recombinant Human LEFTY1 Protein, His-tagged | +Inquiry |
| Lefty1-1765M | Recombinant Mouse Left Right Determination Factor 1 | +Inquiry |
| LEFTY1-003H | Recombinant Human LEFTY1 Protein, Fc-tagged | +Inquiry |
| Lefty1-10588M | Recombinant Mouse Lefty1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LEFTY1-980HCL | Recombinant Human LEFTY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEFTY1 Products
Required fields are marked with *
My Review for All LEFTY1 Products
Required fields are marked with *
