Recombinant Rat Mfge8 protein(23-427aa), His-tagged
| Cat.No. : | Mfge8-669R |
| Product Overview : | Recombinant Rat Mfge8 protein(P70490)(23-427aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-427aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.1 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ASGDFCDSSLCLNGGTCLMGQDNDIYCLCPEGFTGLVCNETEKGPCSPNPCFHDAKCLVTEDTQRGDIFTEYICQCPVGYSGIHCELGCSTKLGLEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASSYDSKPWIQVDFLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRRFEFIQDESGTGDKEFMGNQDNNSLKINMFNPTLEAQYIRLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQITASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQKKVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGTSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPLSWHNRITLRLELLGC |
| Gene Name | Mfge8 milk fat globule-EGF factor 8 protein [ Rattus norvegicus ] |
| Official Symbol | Mfge8 |
| Synonyms | MFGE8; milk fat globule-EGF factor 8 protein; lactadherin; MFGM; SED1; MFG-E8; O-acetyl GD3 ganglioside synthase; O-acetyl disialoganglioside synthase; O-acetyltransferase milk fat globule membrane protein; O-acetyltransferase Milk fat glolbule membrane protein; AGS; MFGME8; OAcGD3S; MFGMP-E8; |
| Gene ID | 25277 |
| mRNA Refseq | NM_001040186 |
| Protein Refseq | NP_001035276 |
| ◆ Recombinant Proteins | ||
| Mfge8-4056M | Recombinant Mouse Mfge8 Protein, Myc/DDK-tagged | +Inquiry |
| MFGE8-3466H | Recombinant Human MFGE8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MFGE8-4385H | Recombinant Human MFGE8 Protein, GST-tagged | +Inquiry |
| Mfge8-407M | Active Recombinant Mouse Mfge8, His-tagged | +Inquiry |
| MFGE8-688C | Recombinant Cynomolgus MFGE8 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MFGE8-8518B | Native Bovine MFGE8, Fluoresence-labeled | +Inquiry |
| MFGE8-289B | Native MFG-E8 | +Inquiry |
| MFGE8-288B | Native Bovine Lactadherin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MFGE8-422HCL | Recombinant Human MFGE8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mfge8 Products
Required fields are marked with *
My Review for All Mfge8 Products
Required fields are marked with *
