Recombinant Rat Mfge8 protein(23-427aa), His-tagged

Cat.No. : Mfge8-669R
Product Overview : Recombinant Rat Mfge8 protein(P70490)(23-427aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 23-427aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 51.1 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : ASGDFCDSSLCLNGGTCLMGQDNDIYCLCPEGFTGLVCNETEKGPCSPNPCFHDAKCLVTEDTQRGDIFTEYICQCPVGYSGIHCELGCSTKLGLEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASSYDSKPWIQVDFLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRRFEFIQDESGTGDKEFMGNQDNNSLKINMFNPTLEAQYIRLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQITASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQKKVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGTSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPLSWHNRITLRLELLGC
Gene Name Mfge8 milk fat globule-EGF factor 8 protein [ Rattus norvegicus ]
Official Symbol Mfge8
Synonyms MFGE8; milk fat globule-EGF factor 8 protein; lactadherin; MFGM; SED1; MFG-E8; O-acetyl GD3 ganglioside synthase; O-acetyl disialoganglioside synthase; O-acetyltransferase milk fat globule membrane protein; O-acetyltransferase Milk fat glolbule membrane protein; AGS; MFGME8; OAcGD3S; MFGMP-E8;
Gene ID 25277
mRNA Refseq NM_001040186
Protein Refseq NP_001035276

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Mfge8 Products

Required fields are marked with *

My Review for All Mfge8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon