Recombinant Rat NOX4 Protein (210-424 aa), His-tagged
| Cat.No. : | NOX4-1475R |
| Product Overview : | Recombinant Rat NOX4 Protein (210-424 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 210-424 aa |
| Description : | Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 40.6 kDa |
| AA Sequence : | GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Nox4 NADPH oxidase 4 [ Rattus norvegicus ] |
| Official Symbol | NOX4 |
| Synonyms | NOX4; NADPH oxidase 4; kox-1; kidney oxidase-1; |
| Gene ID | 85431 |
| mRNA Refseq | NM_053524 |
| Protein Refseq | NP_445976 |
| UniProt ID | Q924V1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOX4 Products
Required fields are marked with *
My Review for All NOX4 Products
Required fields are marked with *
