Recombinant Rat NOX4 Protein (210-424 aa), His-tagged

Cat.No. : NOX4-1475R
Product Overview : Recombinant Rat NOX4 Protein (210-424 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Yeast
Tag : His
Protein Length : 210-424 aa
Description : Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 40.6 kDa
AA Sequence : GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Nox4 NADPH oxidase 4 [ Rattus norvegicus ]
Official Symbol NOX4
Synonyms NOX4; NADPH oxidase 4; kox-1; kidney oxidase-1;
Gene ID 85431
mRNA Refseq NM_053524
Protein Refseq NP_445976
UniProt ID Q924V1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOX4 Products

Required fields are marked with *

My Review for All NOX4 Products

Required fields are marked with *

0
cart-icon
0
compare icon