Recombinant Rat NQO2 Protein (1-231 aa), His-tagged

Cat.No. : NQO2-1673R
Product Overview : Recombinant Rat NQO2 Protein (1-231 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Yeast
Tag : His
Protein Length : 1-231 aa
Description : The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.3 kDa
AA Sequence : MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Nqo2 NAD(P)H dehydrogenase, quinone 2 [ Rattus norvegicus ]
Official Symbol NQO2
Synonyms NQO2; QR2; quinone reductase 2; MGC94180;
Gene ID 291084
mRNA Refseq NM_001004214
Protein Refseq NP_001004214
UniProt ID Q6AY80

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NQO2 Products

Required fields are marked with *

My Review for All NQO2 Products

Required fields are marked with *

0
cart-icon