Recombinant Rat Ocm protein, His-tagged
| Cat.No. : | Ocm-4444R |
| Product Overview : | Recombinant Rat Ocm protein(P02631)(2-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-109aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.0 kDa |
| AA Sequence : | SITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Ocm oncomodulin [ Rattus norvegicus ] |
| Official Symbol | Ocm |
| Synonyms | OCM; oncomodulin; parvalbumin beta; OM; oncmodulin; |
| Gene ID | 25503 |
| mRNA Refseq | NM_012995 |
| Protein Refseq | NP_037127 |
| ◆ Recombinant Proteins | ||
| OCM-4154R | Recombinant Rat OCM Protein | +Inquiry |
| Ocm-4444R | Recombinant Rat Ocm protein, His-tagged | +Inquiry |
| OCM-6309M | Recombinant Mouse OCM Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ocm-3299M | Recombinant Mouse Ocm protein, His-SUMO-tagged | +Inquiry |
| OCM-1441H | Recombinant Human OCM, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OCM-453HCL | Recombinant Human OCM lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ocm Products
Required fields are marked with *
My Review for All Ocm Products
Required fields are marked with *


