Recombinant Rat Pla2g10 protein, His&Myc-tagged
| Cat.No. : | Pla2g10-7844R |
| Product Overview : | Recombinant Rat Pla2g10 protein(Q9QZT3)(29-151aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 29-151a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYYHDCCYSQAQDAGCSPKLYRYPWKCMDHRILCGPAENKCQELLCRCDETLAYCLADTEYHLKYLFFPSVLCEKDSPKCN |
| Gene Name | Pla2g10 phospholipase A2, group X [ Rattus norvegicus ] |
| Official Symbol | Pla2g10 |
| Synonyms | PLA2G10; phospholipase A2, group X; group 10 secretory phospholipase A2; GX sPLA2; group X phospholipase A2; phospholipase A2, group 10; group X secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 10; phosphatidylcholine 2-acylhydrolase GX; PLA2GX; sPLA2-X; |
| Gene ID | 29359 |
| mRNA Refseq | NM_017176 |
| Protein Refseq | NP_058872 |
| ◆ Recombinant Proteins | ||
| Pla2g10-1272M | Recombinant Mouse Pla2g10 protein, His&Myc-tagged | +Inquiry |
| PLA2G10-4485R | Recombinant Rat PLA2G10 Protein, Fc tagged | +Inquiry |
| PLA2G10-1691H | Recombinant Human PLA2G10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLA2G10-4098C | Recombinant Chicken PLA2G10 | +Inquiry |
| PLA2G10-103HFL | Recombinant Full Length Human PLA2G10 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLA2G10-3145HCL | Recombinant Human PLA2G10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pla2g10 Products
Required fields are marked with *
My Review for All Pla2g10 Products
Required fields are marked with *



