Recombinant Rat PLAUR Protein (25-299 aa), His-tagged
| Cat.No. : | PLAUR-1488R |
| Product Overview : | Recombinant Rat PLAUR Protein (25-299 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 25-299 aa |
| Description : | Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 32.8 kDa |
| AA Sequence : | LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Plaur plasminogen activator, urokinase receptor [ Rattus norvegicus ] |
| Official Symbol | PLAUR |
| Synonyms | PLAUR; U-PAR; Par; uPAR; Plaur3; uPAR-2; uPAR-3; |
| Gene ID | 50692 |
| mRNA Refseq | NM_017350 |
| Protein Refseq | NP_059046 |
| UniProt ID | P49616 |
| ◆ Recombinant Proteins | ||
| Plaur-10609M | Recombinant Mouse Plaur Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLAUR-4657H | Active Recombinant Human PLAUR Protein, His-tagged, Site-specific PE-Labeled | +Inquiry |
| PLAUR-338HFL | Active Recombinant Full Length Human PLAUR Protein, C-Flag-tagged | +Inquiry |
| PLAUR-392H | Active Recombinant Human PLAUR protein, His-tagged | +Inquiry |
| PLAUR-1289H | Recombinant Human PLAUR Protein (Leu23-Arg303), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLAUR-2551MCL | Recombinant Mouse PLAUR cell lysate | +Inquiry |
| PLAUR-1888HCL | Recombinant Human PLAUR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAUR Products
Required fields are marked with *
My Review for All PLAUR Products
Required fields are marked with *



