Recombinant Rat PLAUR Protein (25-299 aa), His-tagged

• Cat.No.: PLAUR-1488R
• Product Overview: Recombinant Rat PLAUR Protein (25-299 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• Protein Length: 25-299 aa
• Description: Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 32.8 kDa
• AA Sequence: LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Plaur plasminogen activator, urokinase receptor [ Rattus norvegicus ]
• Official Symbol: PLAUR
• Synonyms: PLAUR; U-PAR; Par; uPAR; Plaur3; uPAR-2; uPAR-3
• Gene ID: 50692
• mRNA Refseq: NM_017350
• Protein Refseq: NP_059046
• UniProt ID: P49616