Recombinant Rat PRSS1 Protein (24-246 aa), His-SUMO-tagged
Cat.No. : | PRSS1-746R |
Product Overview : | Recombinant Rat PRSS1 Protein (24-246 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-246 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 39.6 kDa |
AA Sequence : | IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Prss1 protease, serine, 1 (trypsin 1) [ Rattus norvegicus ] |
Official Symbol | PRSS1 |
Synonyms | PRSS1; Try1; PTRYI; RATPTRYI; |
Gene ID | 24691 |
mRNA Refseq | NM_012635 |
Protein Refseq | NP_036767 |
UniProt ID | P00762 |
◆ Recombinant Proteins | ||
PRSS1-3373H | Recombinant Human PRSS1 protein, His&Myc-tagged | +Inquiry |
PRSS1-6015H | Recombinant Human PRSS1 Protein (Ala16-Ser247), C-His and Fc tagged | +Inquiry |
PRSS1-5894H | Recombinant Human PRSS1 protein, Fc/His-tagged | +Inquiry |
PRSS1-1047H | Active Recombinant Human PRSS1, His-tagged | +Inquiry |
Prss1-1990M | Recombinant Mouse Prss1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRSS1-2806HCL | Recombinant Human PRSS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRSS1 Products
Required fields are marked with *
My Review for All PRSS1 Products
Required fields are marked with *
0
Inquiry Basket