Recombinant Rat PRSS1 Protein (24-246 aa), His-SUMO-tagged

Cat.No. : PRSS1-746R
Product Overview : Recombinant Rat PRSS1 Protein (24-246 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&SUMO
Protein Length : 24-246 aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 39.6 kDa
AA Sequence : IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Prss1 protease, serine, 1 (trypsin 1) [ Rattus norvegicus ]
Official Symbol PRSS1
Synonyms PRSS1; Try1; PTRYI; RATPTRYI;
Gene ID 24691
mRNA Refseq NM_012635
Protein Refseq NP_036767
UniProt ID P00762

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRSS1 Products

Required fields are marked with *

My Review for All PRSS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon