Recombinant Rat PRSS1 Protein (24-246 aa), His-SUMO-tagged

• Cat.No.: PRSS1-746R
• Product Overview: Recombinant Rat PRSS1 Protein (24-246 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 24-246 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 39.6 kDa
• AA Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Prss1 protease, serine, 1 (trypsin 1) [ Rattus norvegicus ]
• Official Symbol: PRSS1
• Synonyms: PRSS1; Try1; PTRYI; RATPTRYI
• Gene ID: 24691
• mRNA Refseq: NM_012635
• Protein Refseq: NP_036767
• UniProt ID: P00762