Recombinant Rat PRSS1 Protein (24–246 aa), His-tagged
| Cat.No. : | PRSS1-1494R |
| Product Overview : | Recombinant Rat PRSS1 Protein (24–246 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 24–246 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 23.1 kDa |
| AA Sequence : | IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Prss1 protease, serine, 1 (trypsin 1) [ Rattus norvegicus ] |
| Official Symbol | PRSS1 |
| Synonyms | PRSS1; pretrypsinogen I; Try1; PTRYI; RATPTRYI; |
| Gene ID | 24691 |
| mRNA Refseq | NM_012635 |
| Protein Refseq | NP_036767 |
| UniProt ID | P00762 |
| ◆ Recombinant Proteins | ||
| PRSS1-3635R | Recombinant Rhesus monkey PRSS1 Protein, His-tagged | +Inquiry |
| PRSS1-746R | Recombinant Rat PRSS1 Protein (24-246 aa), His-SUMO-tagged | +Inquiry |
| PRSS1-3925H | Recombinant Human PRSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRSS1-4396R | Recombinant Rat PRSS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Prss1-3466R | Recombinant Rat Prss1, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRSS1-2806HCL | Recombinant Human PRSS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS1 Products
Required fields are marked with *
My Review for All PRSS1 Products
Required fields are marked with *
