Recombinant Rat S100a8 Protein, His-tagged

Cat.No. : S100a8-1361R
Product Overview : Recombinant Rat S100a8 Protein (2-89aa) was expressed in E. coli with N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 2-89 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 14.1 kDa
AA Sequence : ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEF
LVLVIRVGVAAHKDSHKE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name S100a8 S100 calcium binding protein A8 [ Rattus norvegicus (Norway rat) ]
Official Symbol S100a8
Synonyms Mrp8
Gene ID 116547
mRNA Refseq NM_053822.2
Protein Refseq NP_446274.2
UniProt ID P50115

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100a8 Products

Required fields are marked with *

My Review for All S100a8 Products

Required fields are marked with *

0
cart-icon