"S100a8" Related Products

Expand
Expand
Expand

Recombinant Rat S100a8 Protein, His-tagged

Cat.No. : S100a8-1361R
Product Overview : Recombinant Rat S100a8 Protein (2-89aa) was expressed in E. coli with N-terminal His tag.
Source : E. coli
Species : Rat
Tag : His
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 14.1 kDa
AA Sequence : ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEF
LVLVIRVGVAAHKDSHKE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Figure :

Gene Name : S100a8 S100 calcium binding protein A8 [ Rattus norvegicus (Norway rat) ]
Official Symbol : S100a8
Synonyms : Mrp8
Gene ID : 116547
mRNA Refseq : NM_053822.2
Protein Refseq : NP_446274.2
UniProt ID : P50115

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.