Recombinant Rat S100a8 Protein, His-tagged

• Cat.No.: S100a8-1361R
• Product Overview: Recombinant Rat S100a8 Protein (2-89aa) was expressed in E. coli with N-terminal His tag.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 2-89 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 14.1 kDa
• AA Sequence: ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEF
  LVLVIRVGVAAHKDSHKE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: S100a8 S100 calcium binding protein A8 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: S100a8
• Synonyms: Mrp8
• Gene ID: 116547
• mRNA Refseq: NM_053822.2
• Protein Refseq: NP_446274.2
• UniProt ID: P50115