Recombinant Rat SMAD3 Protein, His tagged

Cat.No. : SMAD3-5608R
Product Overview : Recombinant Rat SMAD family member 3 Protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His
Description : Enables several functions, including DNA-binding transcription factor activity; RNA polymerase II transcription regulatory region sequence-specific DNA binding activity; and beta-catenin binding activity. Involved in several processes, including cell surface receptor protein serine/threonine kinase signaling pathway; positive regulation of hydrolase activity; and regulation of gene expression. Located in nucleus. Part of transcription regulator complex. Used to study pre-malignant neoplasm. Human ortholog(s) of this gene implicated in Loeys-Dietz syndrome 3; Lynch syndrome; and pancreatic cancer. Orthologous to human SMAD3 (SMAD family member 3).
Molecular Mass : 49 kDa
AA Sequence : HHHHHHHHMSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Endotoxin : < 1 EU/μg by LAL.
Purity : > 50 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH 7.4
Concentration : Target Protein ~0.2 mg/mL
Gene Name Smad3 SMAD family member 3 [ Rattus norvegicus (Norway rat) ]
Official Symbol SMAD3
Synonyms SMAD3; SMAD family member 3; mothers against decapentaplegic homolog 3; mad3; SMAD 3; MAD homolog 3; mothers against DPP homolog 3; MAD (mothers against decapentaplegic, Drosophila) homolog 3; Madh3;
Gene ID 25631
mRNA Refseq NM_013095
Protein Refseq NP_037227
UniProt ID P84025

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMAD3 Products

Required fields are marked with *

My Review for All SMAD3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon