Recombinant Rat Sncg protein, His-tagged

• Cat.No.: Sncg-4565R
• Product Overview: Recombinant Rat Sncg protein(Q63544)(1-123aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Protein Length: 1-123aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.1 kDa
• AA Sequence: MDVFKKGFSIAREGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKGERGTSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEEGEEAKSGGD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Sncg synuclein, gamma (breast cancer-specific protein 1) [ Rattus norvegicus ]
• Official Symbol: Sncg
• Synonyms: SNCG; synuclein, gamma (breast cancer-specific protein 1); gamma-synuclein; persyn; sensory neuron synuclein
• Gene ID: 64347
• mRNA Refseq: NM_031688
• Protein Refseq: NP_113876