Recombinant Rat Syp Full Length Transmembrane protein, His-tagged
Cat.No. : | Syp-0148R |
Product Overview : | Recombinant Rat Syp protein(P07825)(1-307aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-307aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.8 kDa |
AA Sequence : | MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Syp synaptophysin [ Rattus norvegicus ] |
Official Symbol | Syp |
Synonyms | SYP; synaptophysin; major synaptic vesicle protein p38; Syp1; |
Gene ID | 24804 |
mRNA Refseq | NM_012664 |
Protein Refseq | NP_036796 |
◆ Recombinant Proteins | ||
SYP-6387H | Recombinant Human SYP Protein (Glu50-Met313), N-His tagged | +Inquiry |
Syp-0148R | Recombinant Rat Syp Full Length Transmembrane protein, His-tagged | +Inquiry |
SYP-4403R | Recombinant Rhesus Macaque SYP Protein, His (Fc)-Avi-tagged | +Inquiry |
SYP-2596H | Recombinant Human SYP protein(228-313 aa), N-SUMO & N-His-tagged | +Inquiry |
SYP-2747H | Recombinant Human SYP Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYP-1313HCL | Recombinant Human SYP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Syp Products
Required fields are marked with *
My Review for All Syp Products
Required fields are marked with *
0
Inquiry Basket