Recombinant Rat Taar1 protein, His/SUMO-tagged

Cat.No. : Taar1-45R
Product Overview : Recombinant Rat Taar1(1-332 aa) fused with His/SUMO tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&SUMO
Protein Length : 1-332 a.a.
Description : G-protein coupled receptor that induces cAMP production in response to para-tyramine and other trace amines; also acts as a receptor for catecholamine metabolites and amphetamines.
Form : Tris-based buffer, 50% glycerol
AA Sequence : MHLCHNSANISHTNSNWSRDVRASLYSLISLIILTTLVGNLIVIISISHFKQLHTPTNWL LHSMAVVDFLLGCLVMPYSMVRTVEHCWYFGELFCKLHTSTDIMLSSASILHLAFISIDR YYAVCDPLRYKAKINLAAIFVMILISWSLPAVFAFGMIFLELNLEGVEELYHNQVFCLRG CFPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRANLQVGLEGESRAPQ SKETKAAKTLGIMVGVFLLCWCPFFFCMVLDPFLGYVIPPTLNDTLNWFGYLNSAFNPMV YAFFYPWFRRALKMVLFGKIFQKDSSRSKLFL
Storage : Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Gene Name Taar1 trace-amine-associated receptor 1 [ Rattus norvegicus ]
Official Symbol Taar1
Synonyms TAAR1; trace-amine-associated receptor 1; trace amine-associated receptor 1; Tar1; Trar1; taR-1;
Gene ID 113914
mRNA Refseq NM_134328
Protein Refseq NP_599155
UniProt ID Q923Y9
Chromosome Location 1p12
Pathway Amine ligand-binding receptors, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem;
Function G-protein coupled amine receptor activity; receptor activity; signal transducer activity; trace-amine receptor activity; trace-amine receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Taar1 Products

Required fields are marked with *

My Review for All Taar1 Products

Required fields are marked with *

0
cart-icon
0
compare icon