Recombinant Rat TNFRSF4 Protein, Fc-tagged
Cat.No. : | TNFRSF4-685R |
Product Overview : | Recombinant Rat TNFRSF4 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 271 |
Description : | Predicted to enable tumor necrosis factor-activated receptor activity. Involved in T cell proliferation. Located in cell surface. Human ortholog(s) of this gene implicated in immunodeficiency 16. Orthologous to human TNFRSF4 (TNF receptor superfamily member 4). |
Form : | Lyophilized |
Molecular Mass : | 47.7 kDa |
AA Sequence : | MYVWVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWRSPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Tnfrsf4 tumor necrosis factor receptor superfamily, member 4 [ Rattus norvegicus ] |
Official Symbol | TNFRSF4 |
Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; |
Gene ID | 25572 |
mRNA Refseq | NM_013049 |
Protein Refseq | NP_037181 |
UniProt ID | P15725 |
◆ Recombinant Proteins | ||
TNFRSF4-339H | Recombinant Human TNFRSF4 protein, Fc-tagged | +Inquiry |
RFL10978MF | Recombinant Full Length Mouse Tumor Necrosis Factor Receptor Superfamily Member 4(Tnfrsf4) Protein, His-Tagged | +Inquiry |
Tnfrsf4-547MF | Recombinant Mouse Tnfrsf4 Protein, FITC conjugated | +Inquiry |
TNFRSF4-3246HAF647 | Recombinant Human TNFRSF4 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Tnfrsf4-6763M | Recombinant Mouse Tnfrsf4 Protein (Val20-Pro211), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *