Recombinant Rat Tpc1808, His-tagged

Cat.No. : Tpc1808-660R
Product Overview : Recombinant Rat Tpc1808 produced in E. coli is approximately 29.1 kDa, a single non-glycosylated polypeptide chain containing 275 amino acids, with 6 × His at N-terminu
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Description : Rat Tropic 1808 is a candidate chemotropic factor induced by nerve injury. Tpc1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. Tpc1808 is the gene related to promotion of nerve growth, and both the Tpc1808 gene and the Tpc1808 recombinant protein up-regulate the expression of NF-H in PC12 cells.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Molecular Mass : 29.1 kDa
AA Sequence : MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAG VPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVT TPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTG APVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
Endotoxin : Less than 1 EU/μg of rRtTPC 1808, His as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Usage : This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apport
Reconstitution : We recommend that this vial be briefy centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportion
Gene Name Tpc1808 tropic 1808 [ Rattus norvegicus (Norway rat) ]
Official Symbol Tpc1808
Synonyms Tpc1808;tropic 1808
Gene ID 64560
mRNA Refseq NM_022625.2
Protein Refseq NP_072147.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tpc1808 Products

Required fields are marked with *

My Review for All Tpc1808 Products

Required fields are marked with *

0
cart-icon
0
compare icon