Species : |
Rat |
Source : |
E.coli |
Tag : |
His |
Description : |
Rat Tropic 1808 is a candidate chemotropic factor induced by nerve injury. Tpc1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. Tpc1808 is the gene related to promotion of nerve growth, and both the Tpc1808 gene and the Tpc1808 recombinant protein up-regulate the expression of NF-H in PC12 cells. |
Form : |
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Molecular Mass : |
29.1 kDa |
AA Sequence : |
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAG VPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVT TPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTG APVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS |
Endotoxin : |
Less than 1 EU/μg of rRtTPC 1808, His as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analyses. |
Usage : |
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apport |
Reconstitution : |
We recommend that this vial be briefy centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportion |