Recombinant Rat Tpc1808, His-tagged
Cat.No. : | Tpc1808-660R |
Product Overview : | Recombinant Rat Tpc1808 produced in E. coli is approximately 29.1 kDa, a single non-glycosylated polypeptide chain containing 275 amino acids, with 6 × His at N-terminu |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Description : | Rat Tropic 1808 is a candidate chemotropic factor induced by nerve injury. Tpc1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. Tpc1808 is the gene related to promotion of nerve growth, and both the Tpc1808 gene and the Tpc1808 recombinant protein up-regulate the expression of NF-H in PC12 cells. |
Form : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Molecular Mass : | 29.1 kDa |
AA Sequence : | MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAG VPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVT TPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTG APVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS |
Endotoxin : | Less than 1 EU/μg of rRtTPC 1808, His as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Usage : | This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apport |
Reconstitution : | We recommend that this vial be briefy centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportion |
Gene Name | Tpc1808 tropic 1808 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Tpc1808 |
Synonyms | Tpc1808;tropic 1808 |
Gene ID | 64560 |
mRNA Refseq | NM_022625.2 |
Protein Refseq | NP_072147.1 |
◆ Recombinant Proteins | ||
Tpc1808-660R | Recombinant Rat Tpc1808, His-tagged | +Inquiry |
TPC1808-12R | Recombinant Rat Tropic 1808 | +Inquiry |
TPC1808-909R | Recombinant Rat TPC1808 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tpc1808 Products
Required fields are marked with *
My Review for All Tpc1808 Products
Required fields are marked with *
0
Inquiry Basket