Recombinant Rat TPC1808 protein, His-tagged
Cat.No. : | TPC1808-909R |
Product Overview : | Recombinant Rat TPC1808 protein, fused to His-tag at the N-terminus, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 304 |
Description : | Tropic1808 is a candidate chemotropic factor induced by nerve injury. TPC1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. TPC1808 is the gene related to promotion of nerve growth, and both the TPC1808 gene and the TPC1808 recombinant protein up-regulate the expression of NF-H in PC12 cells. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
Molecular Mass : | Approximately 29.1 kDa, a single non-glycosylated polypeptide chain containing 304 amino acids, with 6 x His at the N-terminus. |
AA Sequence : | MSYYHHHHHHDYDIPTTENLYFQAMDPEFMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAPVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS |
Endotoxin : | Less than 1 EU/µg of rRtTPC1808, His as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TPC1808 |
Official Symbol | TPC1808 |
Synonyms | TPC1808 protein |
Gene ID | 64560 |
mRNA Refseq | NM_022625.2 |
Protein Refseq | NP_072147.1 |
UniProt ID | Q9R0C2 |
◆ Recombinant Proteins | ||
Tpc1808-660R | Recombinant Rat Tpc1808, His-tagged | +Inquiry |
TPC1808-909R | Recombinant Rat TPC1808 protein, His-tagged | +Inquiry |
TPC1808-12R | Recombinant Rat Tropic 1808 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPC1808 Products
Required fields are marked with *
My Review for All TPC1808 Products
Required fields are marked with *
0
Inquiry Basket