Species : |
Rat |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
304 |
Description : |
Tropic1808 is a candidate chemotropic factor induced by nerve injury. TPC1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. TPC1808 is the gene related to promotion of nerve growth, and both the TPC1808 gene and the TPC1808 recombinant protein up-regulate the expression of NF-H in PC12 cells. |
Form : |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
Molecular Mass : |
Approximately 29.1 kDa, a single non-glycosylated polypeptide chain containing 304 amino acids, with 6 x His at the N-terminus. |
AA Sequence : |
MSYYHHHHHHDYDIPTTENLYFQAMDPEFMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAPVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS |
Endotoxin : |
Less than 1 EU/µg of rRtTPC1808, His as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analyses. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |