Recombinant Rat TPC1808 protein, His-tagged

Cat.No. : TPC1808-909R
Product Overview : Recombinant Rat TPC1808 protein, fused to His-tag at the N-terminus, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 304
Description : Tropic1808 is a candidate chemotropic factor induced by nerve injury. TPC1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. TPC1808 is the gene related to promotion of nerve growth, and both the TPC1808 gene and the TPC1808 recombinant protein up-regulate the expression of NF-H in PC12 cells.
Form : Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Molecular Mass : Approximately 29.1 kDa, a single non-glycosylated polypeptide chain containing 304 amino acids, with 6 x His at the N-terminus.
AA Sequence : MSYYHHHHHHDYDIPTTENLYFQAMDPEFMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAPVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
Endotoxin : Less than 1 EU/µg of rRtTPC1808, His as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name TPC1808
Official Symbol TPC1808
Synonyms TPC1808 protein
Gene ID 64560
mRNA Refseq NM_022625.2
Protein Refseq NP_072147.1
UniProt ID Q9R0C2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPC1808 Products

Required fields are marked with *

My Review for All TPC1808 Products

Required fields are marked with *

0
cart-icon