Recombinant Rat Trpa1 protein, His&Myc-tagged

• Cat.No.: Trpa1-5633R
• Product Overview: Recombinant Rat Trpa1 protein(Q6RI86)(960-1125aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&Myc
• Protein Length: 960-1125a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.3 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: IGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPFWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLSMQETRQEAPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDNHCSFQDRFKKERLEQMHSKWNFVLNAVKTKTHCSISHPDI

Gene Information

• Gene Name: Trpa1 transient receptor potential cation channel, subfamily A, member 1 [ Rattus norvegicus ]
• Official Symbol: Trpa1
• Synonyms: TRPA1; transient receptor potential cation channel, subfamily A, member 1; transient receptor potential cation channel subfamily A member 1; ankyrin-like with transmembrane domains protein 1; Anktm1
• Gene ID: 312896
• mRNA Refseq: NM_207608
• Protein Refseq: NP_997491