Recombinant Rat Trpa1 protein, His&Myc-tagged
Cat.No. : | Trpa1-5633R |
Product Overview : | Recombinant Rat Trpa1 protein(Q6RI86)(960-1125aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 960-1125a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | IGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPFWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLSMQETRQEAPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDNHCSFQDRFKKERLEQMHSKWNFVLNAVKTKTHCSISHPDI |
Gene Name | Trpa1 transient receptor potential cation channel, subfamily A, member 1 [ Rattus norvegicus ] |
Official Symbol | Trpa1 |
Synonyms | TRPA1; transient receptor potential cation channel, subfamily A, member 1; transient receptor potential cation channel subfamily A member 1; ankyrin-like with transmembrane domains protein 1; Anktm1; |
Gene ID | 312896 |
mRNA Refseq | NM_207608 |
Protein Refseq | NP_997491 |
◆ Recombinant Proteins | ||
TRPA1-2844H | Active Recombinant Human TRPA1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
TRPA1-343H | Recombinant Human TRPA1 Protein, His-tagged | +Inquiry |
TRPA1-345H | Recombinant Human TRPA1 protein, His-SUMO-tagged | +Inquiry |
TRPA1-3431H | Recombinant Human TRPA1, His-tagged | +Inquiry |
TRPA1-18H | Recombinant Human TRPA1 Protein, N-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRPA1-1841HCL | Recombinant Human TRPA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Trpa1 Products
Required fields are marked with *
My Review for All Trpa1 Products
Required fields are marked with *