Recombinant Rat Unc5b Protein, hIgG/His-tagged

• Cat.No.: Unc5b-005R
• Product Overview: Recombinant Rat Unc5b Protein (27-373aa) with hIgG/His tag was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: Fc&His
• Protein Length: 27-373aa
• Description: A netrin receptor involved in neuronal migration.
• Form: Liquid
• Molecular Mass: 66.0kDa (590aa)
• AA Sequence: GIDSGGQALPDSFPSAPAEQLPHFLLEPEDAYIVKNKPVELHCRAFPATQIYFKCNGEWVSQKGHVTQESLDEATGLRIREVQIEVSRQQVEELFGLEDYWCQCVAWSSSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQACQKTACTTVCPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVLNQRTLNDPKSRPLEPSGD
• Endotoxin: < 1 EU per 1 µg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Unc5b unc-5 netrin receptor B [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Unc5b
• Synonyms: Unc5b; unc-5 netrin receptor B; Unc5h2; netrin receptor UNC5B; protein unc-5 homolog 2; protein unc-5 homolog B; transmembrane receptor Unc5H2; unc-5 homolog 2; unc-5 homolog B
• Gene ID: 60630
• mRNA Refseq: NM_022207
• Protein Refseq: NP_071543
• UniProt ID: O08722