Recombinant Rat Unc5b Protein, hIgG/His-tagged

Cat.No. : Unc5b-005R
Product Overview : Recombinant Rat Unc5b Protein (27-373aa) with hIgG/His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : Fc&His
Protein Length : 27-373aa
Description : A netrin receptor involved in neuronal migration.
Form : Liquid
Molecular Mass : 66.0kDa (590aa)
AA Sequence : GIDSGGQALPDSFPSAPAEQLPHFLLEPEDAYIVKNKPVELHCRAFPATQIYFKCNGEWVSQKGHVTQESLDEATGLRIREVQIEVSRQQVEELFGLEDYWCQCVAWSSSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQACQKTACTTVCPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVLNQRTLNDPKSRPLEPSGD
Endotoxin : < 1 EU per 1 µg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Unc5b unc-5 netrin receptor B [ Rattus norvegicus (Norway rat) ]
Official Symbol Unc5b
Synonyms Unc5b; unc-5 netrin receptor B; Unc5h2; netrin receptor UNC5B; protein unc-5 homolog 2; protein unc-5 homolog B; transmembrane receptor Unc5H2; unc-5 homolog 2; unc-5 homolog B
Gene ID 60630
mRNA Refseq NM_022207
Protein Refseq NP_071543
UniProt ID O08722

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Unc5b Products

Required fields are marked with *

My Review for All Unc5b Products

Required fields are marked with *

0

Inquiry Basket

cartIcon