Recombinant Rat Xcl1 protein

Cat.No. : Xcl1-638R
Product Overview : Recombinant Rat Xcl1 protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 93
Description : The protein's mouse homolog is a cytokine with chemotactic activity for lymphocytes but not for monocytes or neutrophils.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human XCR1 transfected murine BaF3 cells is less than 100 ng/ml, corresponding to a specific activity of > 1.0 × 10⁴ IU/mg.
Molecular Mass : Approximately 10.0 kDa, a single non-glycosylated polypeptide chain containing 93 amino acids.
AA Sequence : VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG
Endotoxin : Less than 0.1 EU/μg of rRtLymphotactin/XCL1 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Xcl1
Official Symbol Xcl1
Synonyms XCL1; chemokine (C motif) ligand 1; lymphotactin; cytokine SCM-1; c motif chemokine 1; small-inducible cytokine C1; small inducible cytokine subfamily C, member 1 (lymphotactin); Ltn; Scyc1;
Gene ID 171371
mRNA Refseq NM_134361
Protein Refseq NP_599188
UniProt ID P51672

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Xcl1 Products

Required fields are marked with *

My Review for All Xcl1 Products

Required fields are marked with *

0
cart-icon
0
compare icon