Recombinant Rhesus CXCL13 protein

Cat.No. : CXCL13-1322R
Product Overview : Recombinant Rhesus CXCL13 protein was expressed in Escherichia coli.
Availability January 04, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : E.coli
Tag : Non
Protein Length : 87
Description : B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20mM Tris-HCl, pH 8.0, 300mM NaCl.
Molecular Mass : Approximately 10.3 kDa, a single non-glycosylated polypeptide chain containing 87 amino acids.
AA Sequence : VLEVYYTHLRCRCVQESSVFIPRRFIDRIQISPRGNGCPRKEIIVWKKNKSVVCVDPQAEWIQRIMEMLRKKSSSTPPVPVFKRKIP
Endotoxin : Less than 0.01 EU/μg of rRhCXCL-13 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 centigrade as supplied.1 month, 2 to 8 centigrade under sterile conditions after reconstitution.3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CXCL13
Official Symbol CXCL13
Gene ID 574224
mRNA Refseq NM_001032880.1
Protein Refseq NP_001028052.1
UniProt ID Q8HYN9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL13 Products

Required fields are marked with *

My Review for All CXCL13 Products

Required fields are marked with *

0
cart-icon
0
compare icon