Recombinant Rhesus CXCL13 protein

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Rhesus CXCL13 protein

Recombinant Rhesus CXCL13 protein

CXCL13 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CXCL13-1322R
Product Overview : Recombinant Rhesus CXCL13 protein was expressed in Escherichia coli.
Description : B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches.
Source : E.coli
Species : Rhesus
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20mM Tris-HCl, pH 8.0, 300mM NaCl.
Molecular Mass : Approximately 10.3 kDa, a single non-glycosylated polypeptide chain containing 87 amino acids.
Protein length : 87
AA Sequence : VLEVYYTHLRCRCVQESSVFIPRRFIDRIQISPRGNGCPRKEIIVWKKNKSVVCVDPQAEWIQRIMEMLRKKSSSTPPVPVFKRKIP
Endotoxin : Less than 0.01 EU/μg of rRhCXCL-13 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 centigrade as supplied.1 month, 2 to 8 centigrade under sterile conditions after reconstitution.3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : CXCL13
Official Symbol : CXCL13
Gene ID : 574224
mRNA Refseq : NM_001032880.1
Protein Refseq : NP_001028052.1
UniProt ID : Q8HYN9

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.