Recombinant Rhesus macaque OSM protein, His-tagged
Cat.No. : | OSM-2267R |
Product Overview : | Recombinant Rhesus macaque OSM protein(F7GF43)(1-231aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 1-231aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.8 kDa |
AA Sequence : | MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
◆ Recombinant Proteins | ||
OSM-657H | Active Recombinant Human OSM, Fc-tagged, Biotinylated | +Inquiry |
OSM-4208R | Recombinant Rat OSM Protein | +Inquiry |
OSM-1589H | Recombinant Human OSM Protein, His (Fc)-Avi-tagged | +Inquiry |
OSM-346H | Recombinant Human Oncostatin M, His-tagged | +Inquiry |
Osm-4358M | Recombinant Mouse Osm Protein | +Inquiry |
◆ Native Proteins | ||
Osm-3256R | Recombinant Rhesus Monkey OSM Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *