Recombinant Rhesus macaque TNFRSF17 Protein, Fc-tagged
Cat.No. : | TNFRSF17-100R |
Product Overview : | Recombinant Rhesus macaque TNFRSF17 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 183 |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. |
Form : | Lyophilized |
Molecular Mass : | 32.1 kDa |
AA Sequence : | MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNAILWTCLGLSLIISLAVFVLTFLLRKMSSEPLKDEFKNTGSGLLGMANIDLEKGRTGDEIVLPRGLEYTVEECTCEDCIKNKPKVDSDHCFPLPAMEEGATILVTTKTNDYCNSLSAALSVTEIEKSISAR |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | TNFRSF17 tumor necrosis factor receptor superfamily, member 17 [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | TNFRSF17 |
Synonyms | TNFRSF17; tumor necrosis factor receptor superfamily, member 17; tumor necrosis factor receptor superfamily member 17; |
Gene ID | 712212 |
mRNA Refseq | XM_001106892 |
Protein Refseq | XP_001106892 |
UniProt ID | A0A2K5UD97 |
◆ Recombinant Proteins | ||
Tnfrsf17-7442R | Recombinant Rat Tnfrsf17, Fc-tagged | +Inquiry |
TNFRSF17-778H | Recombinant Human TNFRSF17 protein, His-Avi-tagged | +Inquiry |
TNFRSF17-1817HA | Recombinant Human TNFRSF17 protein, Fc-tagged, APC labeled | +Inquiry |
TNFRSF17-1817HAF647 | Active Recombinant Human TNFRSF17 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
TNFRSF17-1817HAF488 | Active Recombinant Human TNFRSF17 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF17-2489HCL | Recombinant Human TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-2593MCL | Recombinant Mouse TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-1253CCL | Recombinant Cynomolgus TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-1489RCL | Recombinant Rat TNFRSF17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF17 Products
Required fields are marked with *
My Review for All TNFRSF17 Products
Required fields are marked with *