Recombinant Rhesus macaque TNFRSF17 Protein, Fc-tagged

Cat.No. : TNFRSF17-100R
Product Overview : Recombinant Rhesus macaque TNFRSF17 protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : HEK293
Tag : Fc
Protein Length : 183
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.
Form : Lyophilized
Molecular Mass : 32.1 kDa
AA Sequence : MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNAILWTCLGLSLIISLAVFVLTFLLRKMSSEPLKDEFKNTGSGLLGMANIDLEKGRTGDEIVLPRGLEYTVEECTCEDCIKNKPKVDSDHCFPLPAMEEGATILVTTKTNDYCNSLSAALSVTEIEKSISAR
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name TNFRSF17 tumor necrosis factor receptor superfamily, member 17 [ Macaca mulatta (Rhesus monkey) ]
Official Symbol TNFRSF17
Synonyms TNFRSF17; tumor necrosis factor receptor superfamily, member 17; tumor necrosis factor receptor superfamily member 17;
Gene ID 712212
mRNA Refseq XM_001106892
Protein Refseq XP_001106892
UniProt ID A0A2K5UD97

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF17 Products

Required fields are marked with *

My Review for All TNFRSF17 Products

Required fields are marked with *

0
cart-icon
0
compare icon