Recombinant Rhesus macaque TNFRSF17 Protein, Fc-tagged

• Cat.No.: TNFRSF17-100R
• Product Overview: Recombinant Rhesus macaque TNFRSF17 protein with Fc tag was expressed in HEK293.

Specification

• Species: Rhesus macaque
• Source: HEK293
• Tag: Fc
• Protein Length: 183
• Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.
• Form: Lyophilized
• Molecular Mass: 32.1 kDa
• AA Sequence: MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNAILWTCLGLSLIISLAVFVLTFLLRKMSSEPLKDEFKNTGSGLLGMANIDLEKGRTGDEIVLPRGLEYTVEECTCEDCIKNKPKVDSDHCFPLPAMEEGATILVTTKTNDYCNSLSAALSVTEIEKSISAR
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: TNFRSF17 tumor necrosis factor receptor superfamily, member 17 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: TNFRSF17
• Synonyms: TNFRSF17; tumor necrosis factor receptor superfamily, member 17; tumor necrosis factor receptor superfamily member 17
• Gene ID: 712212
• mRNA Refseq: XM_001106892
• Protein Refseq: XP_001106892
• UniProt ID: A0A2K5UD97