Recombinant Rhesus monkey IL10 protein, His/GST-tagged

Cat.No. : IL10-21R
Product Overview : Recombinant Rhesus monkey IL10 protein (Arg42~Ser159) was expressed in E. coli with Two N-terminal Tags, His-tag and GST-tag.
Availability August 14, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : E.coli
Tag : GST&His
Protein Length : 42-159 a.a.
Description : IL-10 is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway.
Form : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% Trehalose and Proclin300.
Molecular Mass : 42kDa as determined by SDS-PAGE reducing conditions.
AA Sequence : RELRVAFGRVKTFFQKKDQLDSMLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTFRLRLRRCHRFLPCENKSKAVAQVKNAVSKLQEKGVYKAMS
Purity : >92%
Applications : Positive Control; Immunogen; SDS-PAGE; WB
Stability : Samples are stable for up to twelve months from date of receipt at -70 centigrade.
Storage : Store it under sterile conditions at -20 centigrade to -80 centigrade upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
Concentration : 200µg/mL
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name IL10 interleukin 10 [ Macaca mulatta (Rhesus monkey) ]
Official Symbol IL10
Synonyms IL10 Protein, CSIF Protein, GVHDS Protein, IL-10 Protein, IL10A Protein, Interleukin-10 Protein, Interleukin 10 Protein, TGIF Protein
Gene ID 694931
mRNA Refseq NM_001044727
Protein Refseq NP_001038192
UniProt ID P51496

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL10 Products

Required fields are marked with *

My Review for All IL10 Products

Required fields are marked with *

0
cart-icon