Recombinant Rhesus monkey IL10 protein, His/GST-tagged
Cat.No. : | IL10-21R |
Product Overview : | Recombinant Rhesus monkey IL10 protein (Arg42~Ser159) was expressed in E. coli with Two N-terminal Tags, His-tag and GST-tag. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 42-159 a.a. |
Description : | IL-10 is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. |
Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% Trehalose and Proclin300. |
Molecular Mass : | 42kDa as determined by SDS-PAGE reducing conditions. |
AA Sequence : | RELRVAFGRVKTFFQKKDQLDSMLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTFRLRLRRCHRFLPCENKSKAVAQVKNAVSKLQEKGVYKAMS |
Purity : | >92% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB |
Stability : | Samples are stable for up to twelve months from date of receipt at -70 centigrade. |
Storage : | Store it under sterile conditions at -20 centigrade to -80 centigrade upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. |
Concentration : | 200µg/mL |
Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | IL10 interleukin 10 [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | IL10 |
Synonyms | IL10 Protein, CSIF Protein, GVHDS Protein, IL-10 Protein, IL10A Protein, Interleukin-10 Protein, Interleukin 10 Protein, TGIF Protein |
Gene ID | 694931 |
mRNA Refseq | NM_001044727 |
Protein Refseq | NP_001038192 |
UniProt ID | P51496 |
◆ Recombinant Proteins | ||
IL10-492D | Recombinant Dog IL10 protein, His-tagged | +Inquiry |
IL10-204P | Active Recombinant Pig IL10 Protein (Ser19-Asn175), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Il10-2566M | Recombinant Mouse Il10 protein, His-tagged | +Inquiry |
IL10-20R | Recombinant Rhesus monkey IL10 protein, His-tagged | +Inquiry |
Il10-371I | Active Recombinant Rat Il10 Protein (161 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *
0
Inquiry Basket