Recombinant Rhesus monkey IL10 protein, His/GST-tagged

• Cat.No.: IL10-21R
• Product Overview: Recombinant Rhesus monkey IL10 protein (Arg42~Ser159) was expressed in E. coli with Two N-terminal Tags, His-tag and GST-tag.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Tag: GST&His
• Protein Length: 42-159 a.a.
• Description: IL-10 is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway.
• Form: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% Trehalose and Proclin300.
• Molecular Mass: 42kDa as determined by SDS-PAGE reducing conditions.
• AA Sequence: RELRVAFGRVKTFFQKKDQLDSMLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTFRLRLRRCHRFLPCENKSKAVAQVKNAVSKLQEKGVYKAMS
• Purity: >92%
• Applications: Positive Control; Immunogen; SDS-PAGE; WB
• Stability: Samples are stable for up to twelve months from date of receipt at -70 centigrade.
• Storage: Store it under sterile conditions at -20 centigrade to -80 centigrade upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
• Concentration: 200µg/mL
• Reconstitution: Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: IL10 interleukin 10 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: IL10
• Synonyms: IL10 Protein, CSIF Protein, GVHDS Protein, IL-10 Protein, IL10A Protein, Interleukin-10 Protein, Interleukin 10 Protein, TGIF Protein
• Gene ID: 694931
• mRNA Refseq: NM_001044727
• Protein Refseq: NP_001038192
• UniProt ID: P51496