Recombinant S. aureus Clumping factor A Protein

• Cat.No.: clfA-1169S
• Product Overview: Recombinant S. aureus Clumping factor A Protein (228-558aa) was expressed in E. coli.

Specification

• Species: S.aureus
• Source: E.coli
• Tag: Non
• Protein Length: 228-558 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 52.1 kDa
• AA Sequence: GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Clumping factor A
• Official Symbol: Clumping factor A
• Synonyms: Clumping factor A; Fibrinogen receptor A Fibrinogen-binding protein A; Fibrinogen receptor A; Fibrinogen-binding protein A; clfA
• UniProt ID: Q6GB45