Recombinant S. aureus Clumping factor A Protein

Cat.No. : clfA-1169S
Product Overview : Recombinant S. aureus Clumping factor A Protein (228-558aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : S.aureus
Source : E.coli
Tag : Non
Protein Length : 228-558 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 52.1 kDa
AA Sequence : GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Clumping factor A
Official Symbol Clumping factor A
Synonyms Clumping factor A; Fibrinogen receptor A Fibrinogen-binding protein A; Fibrinogen receptor A; Fibrinogen-binding protein A; clfA
UniProt ID Q6GB45

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Clumping factor A Products

Required fields are marked with *

My Review for All Clumping factor A Products

Required fields are marked with *

0
cart-icon