Recombinant S. aureus Clumping factor A Protein, His-SUMO-tagged
| Cat.No. : | clfA-1170S |
| Product Overview : | Recombinant S. aureus (strain COL) Clumping factor A Protein (229-559aa) was expressed in E. coli N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | S.aureus |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 229-559 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 52.0 kDa |
| AA Sequence : | GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Clumping factor A |
| Official Symbol | Clumping factor A |
| Synonyms | Clumping factor A; Fibrinogen receptor A Fibrinogen-binding protein A; Fibrinogen receptor A; Fibrinogen-binding protein A; clfA |
| UniProt ID | Q5HHM8 |
| ◆ Recombinant Proteins | ||
| clfA-1170S | Recombinant S. aureus Clumping factor A Protein, His-SUMO-tagged | +Inquiry |
| clfA-1169S | Recombinant S. aureus Clumping factor A Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Clumping factor A Products
Required fields are marked with *
My Review for All Clumping factor A Products
Required fields are marked with *
Recently Viewed
