Recombinant Saccharomyces Cerevisiae AUR1 Protein (313-401 aa), His-B2M-Myc-tagged
Cat.No. : | AUR1-2405S |
Product Overview : | Recombinant Saccharomyces Cerevisiae (strain ATCC 204508/S288c) (Baker's yeast) AUR1 Protein (313-401 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-B2M tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | B2M&His&Myc |
Protein Length : | 313-401 aa |
Description : | Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.7 kDa |
AA Sequence : | TKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLNMTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | AUR1; |
UniProt ID | P36107 |
◆ Recombinant Proteins | ||
AUR1-2405S | Recombinant Saccharomyces Cerevisiae AUR1 Protein (313-401 aa), His-B2M-Myc-tagged | +Inquiry |
AUR1-2173A | Recombinant Arabidopsis Thaliana AUR1 Protein (1-294 aa), His-SUMO-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AUR1 Products
Required fields are marked with *
My Review for All AUR1 Products
Required fields are marked with *
0
Inquiry Basket