Species : |
S.cerevisiae |
Source : |
E.coli |
Tag : |
B2M&His&Myc |
Protein Length : |
313-401 aa |
Description : |
Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis. |
Form : |
Tris-based buffer,50% glycerol |
Molecular Mass : |
26.7 kDa |
AA Sequence : |
TKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLNMTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA |
Purity : |
> 85% as determined by SDS-PAGE. |
Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : |
A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |