Recombinant Salmonella Typhimurium PRGJ Protein (1-101 aa), His-SUMO-Myc-tagged

Cat.No. : PRGJ-2176S
Product Overview : Recombinant Salmonella Typhimurium (strain LT2/SGSC1412/ATCC 700720) PRGJ Protein (1-101 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Salmonella Typhimurium
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 1-101 aa
Description : Required for invasion of epithelial cells.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 15.9 kDa
AA Sequence : MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms PrgJ;
UniProt ID P41785

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRGJ Products

Required fields are marked with *

My Review for All PRGJ Products

Required fields are marked with *

0

Inquiry Basket

cartIcon