Recombinant Sheep GDF9 protein, His&Myc-tagged
| Cat.No. : | GDF9-453S |
| Product Overview : | Recombinant Sheep GDF9 protein(O77681)(319-453aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Sheep |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 319-453a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 22.9 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR |
| Gene Name | GDF9 growth differentiation factor 9 [ Ovis aries ] |
| Official Symbol | GDF9 |
| Synonyms | GDF9; growth differentiation factor 9; growth/differentiation factor 9; GDF-9; |
| Gene ID | 100217402 |
| mRNA Refseq | NM_001142888 |
| Protein Refseq | NP_001136360 |
| ◆ Recombinant Proteins | ||
| Gdf9-643M | Recombinant Mouse Gdf9 Protein, His-tagged | +Inquiry |
| GDF9-5241HF | Recombinant Full Length Human GDF9 Protein, GST-tagged | +Inquiry |
| GDF9-7111C | Recombinant Chicken GDF9 | +Inquiry |
| GDF9-6290M | Recombinant Mouse GDF9 Protein | +Inquiry |
| GDF9-053H | Active Recombinant Human GDF9 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GDF9-5966HCL | Recombinant Human GDF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF9 Products
Required fields are marked with *
My Review for All GDF9 Products
Required fields are marked with *



