Recombinant Sheep IL12B Protein (23-327 aa), His-tagged
Cat.No. : | IL12B-576S |
Product Overview : | Recombinant Sheep IL12B Protein (23-327 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-327 aa |
Description : | Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates mory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 38.5 kDa |
AA Sequence : | IWELEKNVYVVELDWYPNAPGETVVLTCDTPEEDGITWTSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKEPKAKSFLKCEAKDYSGHFTCSWLTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAEKVSMDHREYNKYTVECQEGSACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIKPDPPKNLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFTDQTSAKVTCHKDANIRVQARDRYYSSFWSEWASVSCS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | IL12B interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) [ Ovis aries ] |
Official Symbol | IL12B |
Synonyms | IL12B; IL-12B; CLMF p40; IL-12 subunit p40; IL-12; |
Gene ID | 443472 |
mRNA Refseq | NM_001009438 |
Protein Refseq | NP_001009438 |
UniProt ID | P68220 |
◆ Recombinant Proteins | ||
IL12B-5038G | Recombinant Goat IL12B protein | +Inquiry |
IL12B-272H | Recombinant Human IL12B, StrepII-tagged | +Inquiry |
IL12B-177H | Recombinant Human Interleukin 12B | +Inquiry |
Il12b-01M | Active Recombinant Mouse Il12b Protein, His-Tagged | +Inquiry |
IL12B-172H | Recombinant Human IL12B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12B-1197RCL | Recombinant Rat IL12B cell lysate | +Inquiry |
IL12B-2731HCL | Recombinant Human IL12B cell lysate | +Inquiry |
IL12B-1000MCL | Recombinant Marmoset IL12B cell lysate | +Inquiry |
IL12B-1101MCL | Recombinant Mouse IL12B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12B Products
Required fields are marked with *
My Review for All IL12B Products
Required fields are marked with *
0
Inquiry Basket