Recombinant Sheep IL6 protein, GST-tagged
| Cat.No. : | IL6-3106S |
| Product Overview : | Recombinant Sheep IL6 protein(P29455)(30-208aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Sheep |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 30-208aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.5 kDa |
| AA Sequence : | GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | IL6 interleukin 6 (interferon, beta 2) [ Ovis aries ] |
| Official Symbol | IL6 |
| Synonyms | IL6; interleukin 6 (interferon, beta 2); interleukin-6; IL-6; |
| Gene ID | 443406 |
| mRNA Refseq | NM_001009392 |
| Protein Refseq | NP_001009392 |
| ◆ Recombinant Proteins | ||
| Il6-473R | Recombinant Rat Il6 protein | +Inquiry |
| IL6-09H | Active Recombinant Human IL6 Protein, Pre-aliquoted | +Inquiry |
| IL6-128H | Active Recombinant Human Interleukin 6 (Interferon, Beta 2) | +Inquiry |
| Il6-8668M | Recombinant Mouse Il6, None tagged | +Inquiry |
| IL6-251H | Recombinant Human IL6 Protein (Val30-Met212), C-mFc and 6×His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *
