Recombinant Sheep IL6 protein, GST-tagged
Cat.No. : | IL6-3106S |
Product Overview : | Recombinant Sheep IL6 protein(P29455)(30-208aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | GST |
Protein Length : | 30-208aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.5 kDa |
AA Sequence : | GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IL6 interleukin 6 (interferon, beta 2) [ Ovis aries ] |
Official Symbol | IL6 |
Synonyms | IL6; interleukin 6 (interferon, beta 2); interleukin-6; IL-6; |
Gene ID | 443406 |
mRNA Refseq | NM_001009392 |
Protein Refseq | NP_001009392 |
◆ Recombinant Proteins | ||
Il6-1050G | Recombinant Guinea pig Il6 Protein, His-tagged | +Inquiry |
IL6-040H | Recombinant Human IL6 Protein, non-tagged, Biotinylated | +Inquiry |
IL6-2324H | Recombinant Human IL6 Protein, His-tagged | +Inquiry |
IL6-013F | Recombinant Ferret IL6 Protein, Met1-Ile174, C-His tagged | +Inquiry |
IL6-3576H | Recombinant Human IL6 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IL6-01SFL | Recombinant Full Length Sheep IL6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *