| Species : |
Staphylococcus aureus |
| Source : |
Yeast |
| Tag : |
His |
| Protein Length : |
27-319 aa |
| Description : |
Alpha-hemolysin, S. aureus is a pore-forming toxin secreted by Staphylococcus aureus (S. aureus) and belongs to the cholesterol-dependent cytolysin (CDC) family. Alpha-hemolysin can aggregate into heptamer transmembrane pores on the target cell membrane, leading to cell lysis. Alpha-hemolysin promotes infection mainly by destroying the barrier function of corneal epithelial cells, inhibiting epithelial cell migration and viability, and enhancing the invasive ability of bacteria to host cells. The perforation mechanism of alpha-hemolysin is related to ion imbalance and signaling pathway disorder caused by membrane perforation. Alpha-hemolysin can be used to study the pathological mechanism of infectious keratitis, especially its role in delayed corneal wound healing. Blocking alpha-hemolysin or limiting staphylococcal colonization has become a potential inhibitory strategy for corneal trauma and infectious diseases. |
| Form : |
Lyophilized powder |
| Molecular Mass : |
35 kDa |
| AASequence : |
ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN |
| Endotoxin : |
<1 EU/μg by LAL |
| Purity : |
> 90% by SDS-PAGE |
| Storage : |
Stored at -20 centigrade for 2 years from date of receipt. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 or -80 centigrade for extended storage. |
| Shipping : |
Room temperature in continental US; may vary elsewhere. |
| Reconstitution : |
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. |
| Storage Buffer : |
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0. |
